PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Araip.VL6YY
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Dalbergieae; Arachis
Family G2-like
Protein Properties Length: 376aa    MW: 42090.5 Da    PI: 8.1137
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Araip.VL6YYgenomeNCGR_PGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like102.72.3e-32206261156
      G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRla 56 
                  k+r++W++eLH+rF++a++qLGG++ AtPk+i+elmkv+gLt+++vkSHLQkYRl+
  Araip.VL6YY 206 KQRRCWSQELHKRFLQALQQLGGPDSATPKQIRELMKVDGLTNDEVKSHLQKYRLH 261
                  79****************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129414.556203263IPR017930Myb domain
SuperFamilySSF466898.24E-19204264IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.602.2E-29204264IPR009057Homeodomain-like
TIGRFAMsTIGR015571.5E-28206261IPR006447Myb domain, plants
PfamPF002494.3E-8208259IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 376 aa     Download sequence    Send to blast
MQRLKTMMGS RDYIQALEHE RRKIQVFSKE LPLSLDLVTQ AIEACRQQLS ETTTEYNMNG  60
HNSECSEQTT STDNGPVLEE FIPIKKRPSS PHEEEEDDDD DEQHSHHHRH KISKDNTDKR  120
KSDWLRSVQL WNNPEPSSPP HQEVNNKKGG AVEVKRSGSG GAFQPFHKEK EERVGGGGAK  180
AIASDDLRPP CSSNSSKKEE KEGQRKQRRC WSQELHKRFL QALQQLGGPD SATPKQIREL  240
MKVDGLTNDE VKSHLQKYRL HTRRPSGIVH NNGNPQTTPF VLVGNIFVQP PEYAAAVATS  300
ADLAPAGIYA PVATHPPPPP PRTAAGSTRR PQLKKSSNHM REDHHHSHSE EDRVNHSNSP  360
ASSSSTHTTT TTSPAY
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016176846.10.0PREDICTED: uncharacterized protein LOC107619135
TrEMBLA0A151SE101e-143A0A151SE10_CAJCA; Two-component response regulator ARR2
STRINGGLYMA20G32770.11e-137(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF39183363
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G25550.12e-74G2-like family protein